Lord Saladin Destiny #Papercraft Mask Assembly Timelapse

Please login in order to report media.

  • Uploaded 4 years ago in the category Papercrafts

    I got the Festival of the Lost Papercraft Mask PDF from the Bungie Store.

    I took the pages and traced over them in Illustrator to make a digital cut file.

    Printed them out at work, let our digital die-cutter (Esko Kongsberg) cut and score the whole thing for me.

    I still had to write the numbers on the backs of each of the pieces.

    I then taped and assembled just the Lord Saladin mask at home so far.

    The file work for all (3) masks, plus the free PDF of the Siva Node, took me about 2.5 hours to make.

    The printing took about .5 hours (which my co-worker so graciously did for me)

    The mounting of the print to cardstock took approx .5 hours (which my OTHER co-worker so graciously did for me)

    It ended up being two sheets of printing/substrate approx 48" x 70".

    It took about an hour total to label both sheets worth of pieces.

    And then taping and assembling just the Lord Saladin mask took me about 3 hours.

    I wanted to get them all done before Halloween, but well, took a little longer then expected.

    3 Mask PDF set for sale: http://bungiestore.com/collections/featured/products/festival-of-the-lost-masks-digital-edition

    Free Siva Node PDF: https://www.bungie.net/pubstatic/StaticPages/FestivalOfTheLost/Images/Papercraft-SIVA_NODES.pdf?cv=3983621215&av=678313713

  • lordsaladindestinypapercraftmaskassemblytimelapse